PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00193.1_g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Dof
Protein Properties Length: 283aa    MW: 31949.2 Da    PI: 7.9466
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00193.1_g00003.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof119.31.4e-3762120260
                   zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                              +++ ++cprC+s+ntkfCyynnysl+qPry+Ck+CrryWt+GG+lrnvPvGgg+rknkk
  Rsa1.0_00193.1_g00003.1  62 PQEPRNCPRCNSSNTKFCYYNNYSLAQPRYLCKSCRRYWTEGGSLRNVPVGGGSRKNKK 120
                              67899****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-2861118IPR003851Zinc finger, Dof-type
PfamPF027017.7E-3364120IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.44466120IPR003851Zinc finger, Dof-type
PROSITE patternPS01361068104IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MDHHHYTHHD PDQYQHHQMT IPNNNPYHTI ITTPPPRTTT VDSTTMIMDA EKKMITTMTS  60
RPQEPRNCPR CNSSNTKFCY YNNYSLAQPR YLCKSCRRYW TEGGSLRNVP VGGGSRKNKK  120
LPLLQPNSSS SSPTKNLPDL NPPFVFTSTS NPSKSTHQNN DLSLSFSSPT MRDKEAQGHY  180
GHFAEQAMTG GQNCLFTAPM GMIQFRQDYD NDHSKTDIRF SLDRNKQEIS GGGSKLMFPY  240
GNGDEHHHDH ERHDDGNKTR ESGSSNELWS GIILGGDSGG PTW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL1614911e-136AL161491.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 3.
GenBankCP0026871e-136CP002687.1 Arabidopsis thaliana chromosome 4 sequence.
GenBankTM018A101e-136AF013294.1 Arabidopsis thaliana BAC TM018A10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013607240.11e-143PREDICTED: dof zinc finger protein DOF4.1
RefseqXP_013607241.11e-143PREDICTED: dof zinc finger protein DOF4.1
SwissprotQ9M1611e-128DOF41_ARATH; Dof zinc finger protein DOF4.1
TrEMBLA0A0D3DZT01e-143A0A0D3DZT0_BRAOL; Uncharacterized protein
STRINGBra037401.1-P1e-133(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM146951720
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00940.11e-111Dof family protein